DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Alkbh8

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001178838.1 Gene:Alkbh8 / 366783 RGDID:1304687 Length:664 Species:Rattus norvegicus


Alignment Length:167 Identity:35/167 - (20%)
Similarity:60/167 - (35%) Gaps:46/167 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 MLKDE-VRTVTYRNAMYHNKHLFQGKTVLDVGCGTGI----LSMFAAKAGAAQVIAVDCSNIIEF 128
            :||.| ::.|:|..         |...:.:.|.|..:    |.:...|.|..:.:.:..:....|
  Rat    29 LLKHEGIQAVSYPT---------QSLVIANGGLGNAVSRKQLLLTLEKCGPVEALLMPPNKPYAF 84

  Fly   129 ARQVVIDNNLQDVITVVKGKIEE----IELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKW 189
                           |:...|||    ..:.||.|.:|.:..:...|..|.|         :.:|
  Rat    85 ---------------VIFQTIEESKKAYSILNGKEIIDDLGQKIFLYLNFVE---------KAQW 125

  Fly   190 LKKDGMMFPDRGTLYITAI---EDRQYKDEKINWWDD 223
             ||.|:.....|.|.:..|   |:.:...|.:||.:|
  Rat   126 -KKLGLQALPPGLLVVEEIISSEEEKMLLESVNWTED 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 20/107 (19%)
Alkbh8NP_001178838.1 DUF1891 1..37 CDD:117570 3/7 (43%)
RRM_ALKBH8 42..122 CDD:240877 18/112 (16%)
2OG-FeII_Oxy 152..334 CDD:304390 4/10 (40%)
Methyltransf_11 412..501 CDD:285453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.