DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Prmt7

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001014175.1 Gene:Prmt7 / 361402 RGDID:1304869 Length:693 Species:Rattus norvegicus


Alignment Length:378 Identity:89/378 - (23%)
Similarity:147/378 - (38%) Gaps:97/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NPNANADEMTSRDYYFD--------SYAHFGIHEEMLKDEVRTVTY----RNAMYHNKHLFQGKT 94
            ||...:.|....|.::|        |||      :||.|:.|.:.|    |.|:...|...|...
  Rat     9 NPTTGSLEWLEEDEHYDYHQEIARSSYA------DMLHDKDRNIKYYQGIRAAVSRVKDKGQKAL 67

  Fly    95 VLDVGCGTGILSMFAAKAGAAQVIAVDC-SNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGI 158
            |||:|.|||:|||.|..|||....||:. ..:.|.|.::|..|...|.|.|:.....|:.:  |.
  Rat    68 VLDIGTGTGLLSMMAVTAGADFCYAVEVFKPMAEAAVKIVEKNGFSDKIKVINKHSTEVTV--GP 130

  Fly   159 EG-----VDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKI 218
            :|     .:|:::|.....|..|..|.:..:|....:::|....|.|.|:|...:|.::.     
  Rat   131 DGDLPCRANILVTELFDTELIGEGALPSYEHAHKHLVQEDCEAVPHRATVYAQLVESKRM----- 190

  Fly   219 NW-WDDVYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSC----MVKEVDLYTVQKADLN------- 271
             | |:.::...:    :..:.|.|  ::.|.::  ..|    .|.::.|..|..||..       
  Rat   191 -WSWNKLFPVRV----QTGLGEQL--IIPPSEL--ERCPGAPSVYDIQLNQVSPADFTVLSDVLP 246

  Fly   272 -FSSKFSLCIKRN------DFV-------QALVTYFNIEF-----TKCHKR-LGFSTSPDSTY-- 314
             ||..||..:..:      .||       |.::::::||.     .||... ....|.|....  
  Rat   247 MFSVDFSKQVSSSAACHSKQFVPLASGQAQVVLSWWDIEMDPEGKIKCTMAPFWAQTDPQELQWR 311

  Fly   315 THWKQTVFYL------------------DDH-----MTAKKNEEITGTFQMKP 344
            .||.|.|::|                  ||:     :.....:|....:|::|
  Rat   312 DHWMQCVYFLPQEEPIMQGSPRCLAAHHDDYCVWYSLQRTSPDENNSAYQVRP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 32/105 (30%)
Prmt7NP_001014175.1 AdoMet_MTases 37..>188 CDD:302624 47/152 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.