DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Art8

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster


Alignment Length:312 Identity:114/312 - (36%)
Similarity:172/312 - (55%) Gaps:16/312 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAV 120
            |||.|.:..|||.||||..|...|.||:..||.||:.|.|:|||.||||||.|.|||||..|.||
  Fly     5 YFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGARLVYAV 69

  Fly   121 DCSNI-IEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLY 184
            :.||: .:.|..::.||.|.:|:.|::.::||..||...|.||||:|||||:.|.:|.|||:||.
  Fly    70 EASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMGFYLLHEGMLDSVLL 134

  Fly   185 ARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSC----IRKVAVTEPLVDVV 245
            ||||:||:.|::||...|:::.........|:    |.:|.|..|..    :|....:.|.:..:
  Fly   135 ARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFARKLRTQKSSRPEITQL 195

  Fly   246 DPKQVVSTSCMVKEVDLYTVQKADLNFSSKFS--LCIKRNDFVQALVTYFNIEFTKCHKRLGFST 308
            :|:.::....:...::|..|:.:||: |.:|.  :..::....|....:|:::|.  .:....||
  Fly   196 NPQDLLHEGVVFHWMNLLDVEASDLD-SIQFKEVITAQKAGNHQGFCIWFDVQFP--GEDFVLST 257

  Fly   309 SPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQ--MKPNERNNRDLDFVIDI 358
            ||.|..|||||.|..|.:.......|:....||  ||.:..:.|..:..:|:
  Fly   258 SPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADMRKYNLEVDL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 54/100 (54%)
Art8NP_609478.1 SmtA 1..244 CDD:223574 93/243 (38%)
Methyltransf_18 40..147 CDD:289607 56/106 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.