DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Trmt9b

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001371028.1 Gene:Trmt9b / 319582 MGIID:2442328 Length:447 Species:Mus musculus


Alignment Length:178 Identity:41/178 - (23%)
Similarity:66/178 - (37%) Gaps:49/178 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EMLKDEVRTVTYRNAMYHN----------KHLFQ----GKTVLDVGCGTGILSMFAAKAGAAQVI 118
            |:.|..|.:|....|.|..          :...|    |..|.|:|||||   .:.........:
Mouse     7 ELEKRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPGSLVADIGCGTG---KYLKVNSQVHTL 68

  Fly   119 AVD-CSNIIEFAR----QVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESM 178
            ..| |..::|.||    :|::.:||              .||...:|.|.|||  :|....:.:.
Mouse    69 GCDYCGPLVEIARNRGCEVMVCDNL--------------NLPFRDQGFDAIIS--IGVIHHFSTK 117

  Fly   179 LDTVLYARDKWLKKDGMMFPDRGTL--YITAIEDRQYKDEK----INW 220
                 ..|.:.:|:...:....|.|  |:.|:|.:..:.||    :.|
Mouse   118 -----ERRIRAIKEMARVLAPGGQLMIYVWAMEQKNRRFEKQDVLVPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 25/104 (24%)
Trmt9bNP_001371028.1 Methyltransf_25 48..135 CDD:404528 25/110 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 274..306
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 320..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.