DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and CG32152

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001287079.2 Gene:CG32152 / 317885 FlyBaseID:FBgn0052152 Length:527 Species:Drosophila melanogaster


Alignment Length:333 Identity:109/333 - (32%)
Similarity:184/333 - (55%) Gaps:18/333 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AKKLPAEGSTGDNPNANADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKT 94
            |.::||..........:.|.|||.|:..|:.|...:.....||:.....:::.::|.:||.:.:|
  Fly   151 AGRIPAPPRKVPKELEDLDRMTSADFRHDTAARLDVMRNRQKDQAHMYFFQSVIHHQRHLIKDRT 215

  Fly    95 VLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIE 159
            :|.:.||||.|::.||:.||.:|.|||.|.:..:...||..|..:.||||:.|::::::||..::
  Fly   216 ILVLCCGTGTLALMAAQMGAKRVYAVDYSKVTGYTTLVVRQNGYEGVITVMNGRMKDLKLPTKVD 280

  Fly   160 GVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDV 224
            |   ||..||||||.|||.:..||.|||:||||.|.:.||...||:.|.|:.:.|.|:.|.|.:|
  Fly   281 G---IICNWMGYCLLYESEILEVLEARDRWLKKGGFILPDLAALYLVASEEHKLKSERCNHWRNV 342

  Fly   225 YGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQAL 289
            |||:|:.||:.|:.||.|.:...|::::.:..|..:||...::.||.......|.:.|..:::..
  Fly   343 YGFNMNAIRRYALAEPCVALTTGKKLLTMAHCVLRLDLKRARREDLFIDRNIRLSVNREGYLECF 407

  Fly   290 VTYFNIEFT-------KCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQ---MKP 344
            :.:|.::|:       .|:..|   .||..:.  |.|:|.:::.....:||...||..:   :||
  Fly   408 LLFFEVQFSNSLNFKLSCNPCL---KSPFKSL--WMQSVLFVEQPFVMRKNIHYTGNLKFKTLKP 467

  Fly   345 NERNNRDL 352
            |:.|..::
  Fly   468 NKFNEMEI 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 47/99 (47%)
CG32152NP_001287079.2 AdoMet_MTases 215..315 CDD:100107 48/102 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440103
Domainoid 1 1.000 84 1.000 Domainoid score I1911
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000206
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.