DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Ndufaf5

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001119843.1 Gene:Ndufaf5 / 296190 RGDID:1309829 Length:343 Species:Rattus norvegicus


Alignment Length:393 Identity:77/393 - (19%)
Similarity:128/393 - (32%) Gaps:135/393 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VAKKLPAEGSTG---------------DNPNANADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVT 78
            ||..:|..|||.               .|..|...|....||              ||:|:.: .
  Rat    29 VASSVPPSGSTSPRALNIFDRELKRKQKNWAARQPEPMKFDY--------------LKEEIGS-R 78

  Fly    79 YRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVIT 143
            ..:.:|.....|  ...||:|||.|.::....|....::...|   |.|.|    :.|:::..|.
  Rat    79 IADRVYDIARDF--PLALDIGCGRGYIAQHLNKETVGKIFQTD---IAEHA----LKNSIETDIP 134

  Fly   144 VVKGKIEEIELPNGIEGVDIIIS----EWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLY 204
            .|....:|..||......|:::|    .|:.   .....|:.:.|.    ||.||:..   |.::
  Rat   135 TVNILADEEFLPFPENTFDLVVSSLSLHWVN---DLPRALEQIHYV----LKPDGVFV---GAMF 189

  Fly   205 ITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTE----------PLVDVVDPKQVVSTSCM-VK 258
                           ..|.:|  ::.|..::|.||          |...|.|...::..:.. ..
  Rat   190 ---------------GGDTLY--ELRCSLQLAETEREGGFSPHISPFTAVNDLGHLLGRAGFNTL 237

  Fly   259 EVDLYTVQKADLNFSSKFSL-----------C-------IKRNDFVQALVTYFNIEFTKCHKRLG 305
            .||...:|   :|:...|.|           |       :.|:..:.|...|          |..
  Rat   238 TVDTDEIQ---VNYPGMFELMEDLKGMGESNCSWNRKALLHRDTMLAAAAVY----------REM 289

  Fly   306 FSTSPDS---TYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDFVIDINFKGELSQI 367
            :|....|   ||..:         ||...|..:    .|.:|.||.:..:.|       |:|:::
  Rat   290 YSNEDGSIPATYQIY---------HMIGWKYHD----SQARPAERGSATVSF-------GDLARL 334

  Fly   368 QES 370
            .::
  Rat   335 NDT 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 24/103 (23%)
Ndufaf5NP_001119843.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..40 5/10 (50%)
BioC 74..310 CDD:273953 56/294 (19%)
Methyltransf_11 94..185 CDD:285453 26/104 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.