DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and Prmt9

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001178528.1 Gene:Prmt9 / 291947 RGDID:1306157 Length:841 Species:Rattus norvegicus


Alignment Length:364 Identity:93/364 - (25%)
Similarity:152/364 - (41%) Gaps:58/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ESATGITPNSNANSNNVAKKLPAEGSTGD-----------NPNANADEMTSRDYYFDSYAHFGIH 66
            |.|..:.|:.....|::.:.|...|...:           ||:.|  :.....|...::.....|
  Rat    91 EQALELFPDDEVICNSMGEHLFRMGFRDEAAGYFHKAVKLNPDFN--DAKENFYRVANWLVERWH 153

  Fly    67 EEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCS-NIIEFAR 130
            ..||.|..|...| ||..........|||||:|.|||||||||.||||..|.|.:.| .:.|.|.
  Rat   154 FIMLNDTKRNEIY-NAAIQKAVRLGSKTVLDIGAGTGILSMFAKKAGAHSVYACELSKTMYELAC 217

  Fly   131 QVVIDNNLQDVITVVKGKIEEIELPNGI-EGVDIIISEWMGYCLFYESMLDTVLYARDKWL---- 190
            .||..|.::|.|.::..|..::|:|..| |.|.::::|.:...:|.|.:::::::|.:..|    
  Rat   218 DVVAANKMEDGIRLLHMKSLDLEIPKHIPERVSLVVTETVDAGVFGEGIVESLIHAWEHLLLQPQ 282

  Fly   191 --------KKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDP 247
                    .|.|.:.|....:...|:|..:.:........|:.|..:.  ..|....|....|||
  Rat   283 TKGESGSWGKYGKVIPASAVISGMAVECAEIRRHHRVSAKDIAGIHLP--TNVRFQSPAYASVDP 345

  Fly   248 KQVVS-----------------TSC-MVKEVDLYTVQK-ADLNFSSKFSLCIK--RNDFVQALVT 291
            ::.|.                 |.| .:.:||...:|: ..|......||.:.  :...:.|::.
  Rat   346 EETVEPYTTEKMSGIPGGYRPLTECFQIMKVDFNNLQELKSLATRKPHSLSVPAVKEGTLDAIMV 410

  Fly   292 YFNIEFTKCHKRLGFSTSPDSTYTHWKQTVF---YLDDH 327
            :|.::....|   ..|||| |..|.|:|.|:   .|:|:
  Rat   411 WFVLQLDDEH---SLSTSP-SEETCWEQAVYPVQALEDY 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 40/113 (35%)
Prmt9NP_001178528.1 TPR_11 68..132 CDD:290150 6/40 (15%)
TPR repeat 68..95 CDD:276809 2/3 (67%)
TPR repeat 100..130 CDD:276809 3/29 (10%)
AdoMet_MTases 148..>338 CDD:302624 56/192 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.