DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and K12D9.1

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_503823.2 Gene:K12D9.1 / 187323 WormBaseID:WBGene00019675 Length:354 Species:Caenorhabditis elegans


Alignment Length:268 Identity:55/268 - (20%)
Similarity:91/268 - (33%) Gaps:82/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGK-----------------TVLDVGCGTGILS- 106
            |:.:...|:|.....:||       :.:|:..|.                 .|||||||.|..| 
 Worm   124 YSIYSDFEDMQAMFTKTV-------YEQHMISGLIPAFGNGIKEKLEDGGFRVLDVGCGEGFHSC 181

  Fly   107 MFAAKAGAAQVIAVD-CSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIII--SEW 168
            :.|.....:|.:.:| |...|:.|:.    |...|     ....:.:|...|    |.:|  .:|
 Worm   182 LLAENYSKSQFVGLDICEKAIKSAKL----NKKSD-----GSDFQNLEFVVG----DAMIMPEDW 233

  Fly   169 MGYCL----FYESMLDTV-----LYARDKWLKKDGMMFPDRGTLYITAIEDR---------QYKD 215
            .| |.    |:.|:.|.:     |....:.||..||:............:||         ||..
 Worm   234 TG-CFDLVAFFGSLHDLLRPDLSLLEVHRVLKPGGMVVLTESDGTSNVFQDREAFGKMSALQYGG 297

  Fly   216 EKINWW------DDVYGFDMSCIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSS 274
            ..::..      .|..|:.....||.| ||           :.|.|..|::::..:    ::|..
 Worm   298 SMLHCLPVGSNSSDAMGYGSMWGRKRA-TE-----------LMTKCGFKDIEITPI----IHFPG 346

  Fly   275 KFSLCIKR 282
            .....:|:
 Worm   347 SVFYVLKK 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 30/112 (27%)
K12D9.1NP_503823.2 Methyltransf_31 163..>282 CDD:316372 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.