DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and C35D10.12

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_498018.1 Gene:C35D10.12 / 183240 WormBaseID:WBGene00016448 Length:365 Species:Caenorhabditis elegans


Alignment Length:355 Identity:76/355 - (21%)
Similarity:123/355 - (34%) Gaps:97/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEMLKDEVRTVTYRNAMYHNK------------------HLFQGKTVLDVGCGTGILSMFAAK-- 111
            |.:.::.|.::..|.|.|..|                  ....|..:||||||       .||  
 Worm     6 ENVEQEYVHSIYSRLATYQQKEHKPSSPRIWPRVRQFVDQQSAGSIILDVGCG-------EAKYT 63

  Fly   112 AGAAQVIAVD-CSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFY 175
            :..:.||..| ||.::..:::..||..|.|.|.:          |...:.||.|::..:.:.|..
 Worm    64 SQKSHVIGFDTCSEVLSSSKKDDIDLCLADAINI----------PIRDDSVDAILNVSVIHHLAT 118

  Fly   176 ESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYK----DEKINWWDDVYGFDMSCIRKVA 236
            .:....||....:.|:..|.|.     :|..|.|....|    |..:.|          .:.:.|
 Worm   119 TARRRQVLQECSRCLRIGGQML-----IYAWAFEQPNGKFASQDILVPW----------NMHETA 168

  Fly   237 VTEPL------VDVVDPKQVVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNI 295
            :...|      ::....::|::.|..|...|....||.   ||...|..:...|    .:.||: 
 Worm   169 IGGRLPKVKFHLNTTKEQRVIAASIPVNISDGSIPQKW---FSGVLSKVVSLTD----QLPYFS- 225

  Fly   296 EFTKCHKRLGFSTSPDS-TYTHWKQTVFYLDDHMTAK-----------KNEEITGTFQMKPN-ER 347
              .:|         |:| .|::.......|...|..|           .|..|:|..:..|. .|
 Worm   226 --KRC---------PNSPAYSNQSTPTGSLSSPMVQKLPSAAPQFLPTTNSLISGIKRWSPMLGR 279

  Fly   348 NNRDLDFVIDINFKGELSQ--IQESNTYRM 375
            ....|...::..|..||:|  ::||.|..|
 Worm   280 RLASLLVPVEEQFGEELAQTIMRESITEAM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 26/102 (25%)
C35D10.12NP_498018.1 Methyltransf_11 53..141 CDD:369777 28/109 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.