DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and R08F11.4

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_504052.1 Gene:R08F11.4 / 178797 WormBaseID:WBGene00019968 Length:354 Species:Caenorhabditis elegans


Alignment Length:189 Identity:43/189 - (22%)
Similarity:66/189 - (34%) Gaps:69/189 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQ-----------------GKTVLDVGCGTGI 104
            :.:|:.|   |||.:...:.|       |.||:..                 |..|||||||.|.
 Worm   124 YSAYSDF---EEMQQKFTKIV-------HEKHIIPDLVPAIGNGIKEKLEAGGIRVLDVGCGGGF 178

  Fly   105 LS-MFAAKAGAAQVIAVDCS-NIIEFARQVVIDNNLQDVITVVKGKIEEIELPN---GIEGVDII 164
            .| :.|.....:|.:.:|.: ..|:.||              :|.|.:..:..|   .:....|:
 Worm   179 HSGLLAEHYPKSQFVGLDITEKAIKAAR--------------LKKKSDGTDFENLEFVVADAAIM 229

  Fly   165 ISEW---------MGYCLFYESML-DTVLYARDKWLKKDGM-----------MFPDRGT 202
            .|.|         .|.|  ::.|. |..|....:.:|.||:           :|.||.|
 Worm   230 PSSWTDSFDLVILFGSC--HDQMRPDLCLLEVHRVVKPDGLVAVTDVDGSSNVFTDRET 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 27/114 (24%)
R08F11.4NP_504052.1 Methyltransf_31 165..>281 CDD:316372 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.