DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and prmt-9

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001040990.1 Gene:prmt-9 / 178221 WormBaseID:WBGene00011939 Length:680 Species:Caenorhabditis elegans


Alignment Length:344 Identity:73/344 - (21%)
Similarity:131/344 - (38%) Gaps:79/344 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HEEMLKDEVRTVTYRNAMYHNKHLFQGKTVL-DVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFA 129
            |..|:.|..|...:..|:  |..:....||: |:|.||||||..||:.          :|::   
 Worm   142 HIRMINDVKRNEAFAKAL--NDTIKSRITVVFDIGSGTGILSAIAARK----------TNLV--- 191

  Fly   130 RQVVIDNNLQDVITVVKGKIEEIELPNGIEG-----------------VDIIISEWMGYCLFYES 177
              ..::.|:  .:|::.   :|:...||:|.                 .||::||.:..|:|.|.
 Worm   192 --TALEENM--CLTMIS---KEVLKRNGVESRVNVHAKNSTYFETCEKADIVVSETLDCCVFGEK 249

  Fly   178 MLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDMSC----------- 231
            :::|.|.|..::.....:..|.:.|:|:.....|:.             ||:.|           
 Worm   250 IVETFLDAHVRFSHDRTIFIPHQATVYVRLFSCREI-------------FDIHCQDYGGVRYRSE 301

  Fly   232 ---IRKVAVTEP--LVDVVDPKQ--VVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQAL 289
               |.:....:|  .....|..|  ::|.|..:..||..::  |:|..|...|...|.......:
 Worm   302 YVKIGESDAEQPYWCASAADYSQFELLSGSVAMHSVDFSSI--ANLKDSLANSNSFKIRPAKDGV 364

  Fly   290 VTYFNIEFTKCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDF 354
            ...|::.||......|.:....|....|...:....:....|.::|..|::::    .||| ||.
 Worm   365 AHGFSVHFTSDLTGHGDNIIDSSKSRAWDLGIIPFKEPCLVKCDKEYEGSWKL----LNNR-LDV 424

  Fly   355 VIDINFKGELSQIQESNTY 373
            ..|. :...|.:.::|..|
 Worm   425 YNDF-YDENLQKHEDSLRY 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 29/117 (25%)
prmt-9NP_001040990.1 AdoMet_MTases 139..>273 CDD:302624 36/152 (24%)
PRMT5 <153..421 CDD:282971 61/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.