DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and prmt-7

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_492436.2 Gene:prmt-7 / 172727 WormBaseID:WBGene00012298 Length:647 Species:Caenorhabditis elegans


Alignment Length:337 Identity:78/337 - (23%)
Similarity:138/337 - (40%) Gaps:74/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKH-LFQGKT-VLDVGCGTGILSMFA 109
            |.|: :|..:.|....|..:::.|.....|:.      ..|| ...||. |||:|.|||:||:.|
 Worm    25 AQEL-ARSRFGDMILDFDRNDKFLAGLKTTIA------EKKHENTDGKVHVLDIGTGTGLLSLMA 82

  Fly   110 AKAGAAQVIAV-------DCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISE 167
            |:.||.:|.|:       ||      ||.:..::...|.|||:..:..::....| ...|||::|
 Worm    83 AREGADKVTALEVFKPMGDC------ARHITSNSPWSDKITVISERSTDVSQIGG-SRADIIVAE 140

  Fly   168 WMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIED---RQYKD-EKINWWDD----- 223
            .....|..|..|.|...|.::..|....:.|..|.:||..:|.   :.:.| .::|...|     
 Worm   141 VFDTELIGEGALRTFKEALERLAKPGCRVVPSTGNVYIVPVESHLLKMFNDIPRLNGEKDEEPLG 205

  Fly   224 -------VYGFDMSCIRK---VAVTEPLV----DVVDPKQVVSTSCMVKEVDLYTVQKADLNFSS 274
                   |:...:|.::.   ..::||:|    |....::::.....|:|...::          
 Worm   206 RCSGTAAVFDVQLSEMKTHEFRELSEPIVAFKFDFEHEEKIIFDESFVREAVAHS---------- 260

  Fly   275 KFSLCIKRNDFVQALVTYFNIEFTK---CHKRLGFSTSPDSTYT---HWKQTVFYLDDHMTAKKN 333
                    :..:.||:.:::|:..:   ....:|......:.|.   ||.|.|:||.:    ||.
 Worm   261 --------SGTIDALLMWWDIDMDRNGTTFIDMGPKWKNKNNYAWRDHWMQAVYYLPE----KKK 313

  Fly   334 EEITGTFQMKPN 345
            .|:..||::..|
 Worm   314 VEMNQTFEIVCN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 34/107 (32%)
prmt-7NP_492436.2 SmtA 19..258 CDD:223574 61/246 (25%)
AdoMet_MTases 34..>238 CDD:302624 55/216 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.