DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and BUD23

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_006715910.1 Gene:BUD23 / 114049 HGNCID:16405 Length:304 Species:Homo sapiens


Alignment Length:265 Identity:51/265 - (19%)
Similarity:92/265 - (34%) Gaps:84/265 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VLDVGCGTGILSMFAAKAGAAQVIAVDCS-NIIEFA--RQVVIDNNLQDVITVVKGKIEEIELPN 156
            :||:|||||:...:.:..|...| .:|.| .:::.|  |::..|..|.|:...:..|      |.
Human    80 LLDIGCGTGLSGSYLSDEGHYWV-GLDISPAMLDEAVDREIEGDLLLGDMGQGIPFK------PG 137

  Fly   157 GIEG-VDIIISEWMG-------------YCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITA 207
            ..:| :.|...:|:.             || |:.|:...::                ||:..:..
Human   138 TFDGCISISAVQWLCNANKKSENPAKRLYC-FFASLFSVLV----------------RGSRAVLQ 185

  Fly   208 I-EDRQYKDEKINWWDDVYGFDMSCI-------------------RKVAVTEPL---VDVVDPKQ 249
            : .:...:.|.|.......||....:                   ....:.|.|   .|.|:|::
Human   186 LYPENSEQLELITTQATKAGFSGGMVVDYPNSAKAKKFYLCLFSGPSTFIPEGLSENQDEVEPRE 250

  Fly   250 VVSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNIEFTKCHKRLGFSTSPDSTY 314
            .|.|                   :.:|.|.:.|...|:....:. :|..:.|:|.|....||:.|
Human   251 SVFT-------------------NERFPLRMSRRGMVRKSRAWV-LEKKERHRRQGREVRPDTQY 295

  Fly   315 THWKQ 319
            |..|:
Human   296 TGRKR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 25/115 (22%)
BUD23XP_006715910.1 AdoMet_MTases 38..>117 CDD:302624 12/37 (32%)
Methyltransf_11 81..184 CDD:285453 27/126 (21%)
WBS_methylT 227..302 CDD:289366 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.