DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and carm1

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_002942887.1 Gene:carm1 / 100170180 XenbaseID:XB-GENE-484572 Length:602 Species:Xenopus tropicalis


Alignment Length:364 Identity:132/364 - (36%)
Similarity:194/364 - (53%) Gaps:30/364 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TPNSNANSNNVAK--KLPAEGSTGDNPNANADEMTSRDYYFDSYAHFGIHEEMLKDEVRTVTYRN 81
            ||....:..|:.|  :.||   :..:..:...|.:|...||..|.:....:.|::|.|||.||:.
 Frog    84 TPADFCSFYNIIKGCRTPA---SEKSVFSERTEESSAVQYFQFYGYLSQQQNMMQDYVRTGTYQR 145

  Fly    82 AMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVK 146
            |:..|...|:.|.|||||||:||||.||.:|||.:|.||:.|.:.:.|..:|..|||.|.|.|:.
 Frog   146 AILQNHTDFKDKVVLDVGCGSGILSFFAVQAGARKVYAVEASTMAQHAELLVKSNNLTDRIVVIP 210

  Fly   147 GKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDR 211
            ||:||..||   |.|||||||.|||.||.|.||::.|:|: |:||.:|.|||..|.:::....|.
 Frog   211 GKVEETALP---EQVDIIISEPMGYMLFNERMLESYLHAK-KFLKPNGNMFPTIGDVHLAPFTDE 271

  Fly   212 Q-YKDE--KINWW--DDVYGFDMSCIRKVAVTE----PLVDVVDPKQVVSTSCMVKEVDLYTV-- 265
            | |.::  |.|:|  ...:|.|:|.:|..||.|    |:||..|.:.:::.|  ||    |||  
 Frog   272 QLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFKQPVVDTFDIRILMAKS--VK----YTVNF 330

  Fly   266 ---QKADLN-FSSKFSLCIKRNDFVQALVTYFNIEFTKCHKRLGFSTSPDSTYTHWKQTVFYLDD 326
               ::|||: ....||..:..:..|..|..:|::.|......:..||:|....|||.|....|..
 Frog   331 LDAKEADLHRIEIPFSFHMLHSGLVHGLAFWFDVAFIGSIMTVWLSTAPTEPLTHWYQVRCLLQS 395

  Fly   327 HMTAKKNEEITGTFQMKPNERNNRDLDFVIDINFKGELS 365
            .:..|..:.:|||..:..|:|.:.|:..|..::..|..|
 Frog   396 PLFTKAGDTLTGTALLIANKRQSYDISIVAQVDQTGSKS 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 55/99 (56%)
carm1XP_002942887.1 CARM1 9..109 CDD:371585 6/27 (22%)
Methyltransf_25 159..254 CDD:379312 55/98 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.