DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Art1 and carm1l

DIOPT Version :9

Sequence 1:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_009303379.2 Gene:carm1l / 100003090 ZFINID:ZDB-GENE-090312-219 Length:450 Species:Danio rerio


Alignment Length:329 Identity:115/329 - (34%)
Similarity:175/329 - (53%) Gaps:30/329 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DEMTSRDYYFDSYA-HFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAK 111
            |:...|....||.| .:...:.||:|.:||.||:.||..|:..|:.|.||||||||||||.||.:
Zfish   113 DQSVFRQRSEDSSALQYFQQQNMLQDFLRTATYQKAMLLNEDDFKDKVVLDVGCGTGILSFFAVQ 177

  Fly   112 AGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYE 176
            |||.:|.||:.|.:.::|..:|..|.|.:.|||:.|:|||:..|   |.||:||||.|||.|..|
Zfish   178 AGAQKVYAVEASTVAKYAEMLVRSNGLSNKITVLSGRIEEVSCP---EKVDVIISEPMGYMLLNE 239

  Fly   177 SMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDE---KINWWDD--VYGFDMSCIRKVA 236
            .||::.|:|: .|||..|||||.:..:::....|.....|   :.|:|:.  .||.::|.:...|
Zfish   240 RMLESFLHAK-HWLKPKGMMFPTQSDIHLAPFTDEHLYMEHHARSNFWNQSCFYGVNLSGLHSSA 303

  Fly   237 VTE----PLVDVVDPKQVVSTSCM-------VKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALV 290
            |.|    |:||..|.:.:::.|..       .||.||:   :.::.|..|    :.::..:..|.
Zfish   304 VDEFFKQPIVDTFDMQILMARSVKYTINFLEAKEEDLH---RLEIPFVFK----LLQSGLIHGLA 361

  Fly   291 TYFNIEFTKCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNRDLDF- 354
            .:|::.|......:..||||....|||.|....|...:.||..:.::|...:..|:|.:.|:.. 
Zfish   362 FWFDVAFVGSKMTIWLSTSPTEPLTHWYQVRCLLQTPLFAKMGQTLSGHVHLIANKRQSYDIHIS 426

  Fly   355 -VID 357
             |:|
Zfish   427 AVVD 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 52/99 (53%)
carm1lXP_009303379.2 PH-like <32..119 CDD:327399 1/5 (20%)
PRMT5 <101..410 CDD:310055 109/307 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54098
OrthoDB 1 1.010 - - D840669at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.