DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and SRSF9

DIOPT Version :10

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_003760.1 Gene:SRSF9 / 8683 HGNCID:10791 Length:221 Species:Homo sapiens


Alignment Length:103 Identity:38/103 - (36%)
Similarity:52/103 - (50%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPG---FAFVEFEDRRDAEDATRALDGTRCC 73
            ::|||||.:...:.::|..|.|||.:|.:.: :|..|   ||||.|||.||||||....:|....
Human    15 RIYVGNLPTDVREKDLEDLFYKYGRIREIEL-KNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYG 78

  Fly    74 GTRIRVEMS---SGRSRDRRRGEGGSSGRSGSGRYRIT 108
            ..|:|||..   .||....|.|..|...|....|..::
Human    79 QCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVS 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 30/71 (42%)
SRSF9NP_003760.1 RRM1_SRSF9 15..86 CDD:241042 30/71 (42%)
RRM2_SRSF9 104..186 CDD:410161 2/13 (15%)
Interaction with SAFB1 188..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..221
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.