DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and AT1G60000

DIOPT Version :10

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_176208.1 Gene:AT1G60000 / 842294 AraportID:AT1G60000 Length:258 Species:Arabidopsis thaliana


Alignment Length:89 Identity:26/89 - (29%)
Similarity:42/89 - (47%) Gaps:7/89 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWV-----ARNPPGFAFVEFEDRRDAE 61
            |.|.|.:  .|::||||..:.:...:.|||.:.|.:....|     .....|:.||.:..:.:.|
plant   170 PLYPETE--HKLFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEME 232

  Fly    62 DATRALDGTRCCGTRIRVEMSSGR 85
            .|..:|||....|..|||.::.|:
plant   233 TALESLDGFELEGRAIRVNLAQGK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 22/73 (30%)
AT1G60000NP_176208.1 RRM_SF 86..165 CDD:473069
RRM 178..257 CDD:440488 23/79 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.