DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and RSZ21

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_564208.1 Gene:RSZ21 / 838997 AraportID:AT1G23860 Length:187 Species:Arabidopsis thaliana


Alignment Length:90 Identity:44/90 - (48%)
Similarity:55/90 - (61%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGTR 76
            :||||||....::.|:|..|..:|.||||||||.|||:||:||:|.|||.||..|||  |..|.|
plant     3 RVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALD--RKNGWR 65

  Fly    77 IRVEMSSGRSRDRRRGEGGSSGRSG 101
            :.:      |...:.|.||..||.|
plant    66 VEL------SHKDKGGRGGGGGRRG 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 37/68 (54%)
RSZ21NP_564208.1 RRM_SRSF3_like 3..70 CDD:409808 37/74 (50%)
zf-CCHC 90..104 CDD:395050
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3142
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - mtm954
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.