DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and RBM4B

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens


Alignment Length:181 Identity:43/181 - (23%)
Similarity:65/181 - (35%) Gaps:62/181 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGTR 76
            |::|||:..:.:..|:...|.:|||:....:.::   :|||..|...||.:|.|.||.|...|.|
Human    79 KLHVGNISPTCTNQELRAKFEEYGPVIECDIVKD---YAFVHMERAEDAVEAIRGLDNTEFQGKR 140

  Fly    77 IRVEMSSGRSRDRRRGEGGSSG-----------------RSGS---------------------- 102
            :.|::|:.|.| ...|.|..||                 |:|.                      
Human   141 MHVQLSTSRLR-TAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMG 204

  Fly   103 -----------------GRYRITPSARTTSTATSSFYNINNLQQQPSSQPQ 136
                             .|||:.......:.|.:|.||.  .:|..|..||
Human   205 YGESMYYNDAYGALDYYKRYRVRSYEAVAAAAAASAYNY--AEQTMSHLPQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 23/68 (34%)
RBM4BNP_113680.1 RRM1_RBM4 2..68 CDD:410018
RRM2_RBM4 78..144 CDD:410019 22/67 (33%)
PTZ00368 <145..>181 CDD:173561 8/36 (22%)
ZnF_C2HC 161..176 CDD:197667 1/14 (7%)
Interaction with TNPO3. /evidence=ECO:0000250 196..359 11/60 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.