DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and RS41

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_200017.2 Gene:RS41 / 835279 AraportID:AT5G52040 Length:357 Species:Arabidopsis thaliana


Alignment Length:106 Identity:41/106 - (38%)
Similarity:54/106 - (50%) Gaps:14/106 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRC--CGT 75
            |:.||....|.:.::|..|.|||.:..|.:   ..|||||..||.||||||.||||....  .|.
plant     4 VFCGNFEYDARESDLERLFRKYGKVERVDM---KAGFAFVYMEDERDAEDAIRALDRFEYGRTGR 65

  Fly    76 RIRVEMSSGRSRDRRRGEGGSSGRSGSGRYRITPSARTTST 116
            |:|||.:        :.:.|.:||||..| |.:...|.:.|
plant    66 RLRVEWT--------KNDRGGAGRSGGSR-RSSSGLRPSKT 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 31/69 (45%)
RS41NP_200017.2 RRM1_AtRSp31_like 2..73 CDD:409680 32/79 (41%)
RRM 9..289 CDD:223796 38/101 (38%)
RRM2_AtRSp31_like 97..166 CDD:409899 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.