DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and RS31

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_567120.1 Gene:RS31 / 825359 AraportID:AT3G61860 Length:264 Species:Arabidopsis thaliana


Alignment Length:87 Identity:35/87 - (40%)
Similarity:45/87 - (51%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDG------TR 71
            |:|||......:.::|..|.|||.:..|.:   ..|:|||.|||.||||||.|.||.      .|
plant     4 VFVGNFEYETRQSDLERLFDKYGRVDRVDM---KSGYAFVYFEDERDAEDAIRKLDNFPFGYEKR 65

  Fly    72 CCGTRIRVEMSSGRSRDRRRGE 93
                |:.||.:.| .|.|.||:
plant    66 ----RLSVEWAKG-ERGRPRGD 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 29/73 (40%)
RS31NP_567120.1 RRM_SF 2..73 CDD:418427 30/75 (40%)
RRM2_AtRSp31_like 94..163 CDD:409899
PTZ00449 <138..209 CDD:185628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.