DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and RS2Z32

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_190918.3 Gene:RS2Z32 / 824518 AraportID:AT3G53500 Length:284 Species:Arabidopsis thaliana


Alignment Length:105 Identity:46/105 - (43%)
Similarity:61/105 - (58%) Gaps:6/105 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATR 65
            ||||.:.....::|||.|.|.....::|..|::||.:|:|.:.|:   :|||||.|.|||:||..
plant     1 MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRD---YAFVEFSDPRDADDARY 62

  Fly    66 ALDGTRCCGTRIRVEMSSGRSRDRRRGEGGSSG-RSGSGR 104
            .|||....|:||.||.|.|..|..|  :.||.| ..||||
plant    63 YLDGRDFDGSRITVEASRGAPRGSR--DNGSRGPPPGSGR 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 30/68 (44%)
RS2Z32NP_190918.3 RRM_SF 12..81 CDD:388407 32/71 (45%)
PTZ00368 <86..142 CDD:173561 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.