DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and SR34a

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001190041.1 Gene:SR34a / 824105 AraportID:AT3G49430 Length:300 Species:Arabidopsis thaliana


Alignment Length:109 Identity:46/109 - (42%)
Similarity:59/109 - (54%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VYVGNLGSSASKHEIEGAFAKYGPLRNV--WVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGT 75
            :|||||.....:||||..|.|||.:.::  .|...||.:.|||||..||||||.:..||....|.
plant     9 IYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFEHSRDAEDAIKGRDGYNLDGC 73

  Fly    76 RIRVEMSSG----RSRDRR-------RGEGGSSGRSGSGRYRIT 108
            |:|||::.|    .|.|||       .|.||..|..||.|:.::
plant    74 RLRVELAHGGRGQSSSDRRGGYGGGGSGYGGGGGGGGSARFGVS 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 33/69 (48%)
SR34aNP_001190041.1 RRM_SF 9..79 CDD:418427 33/69 (48%)
RRM2_SF2_plant_like 122..197 CDD:410014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.