DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and PSPC1

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001035879.1 Gene:PSPC1 / 55269 HGNCID:20320 Length:523 Species:Homo sapiens


Alignment Length:203 Identity:41/203 - (20%)
Similarity:70/203 - (34%) Gaps:62/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRA 66
            |..:.:...|:::||||.:..::.:.:..|.:||....|::.|: .||.|:..|.|..||.|...
Human    73 PGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRD-RGFGFIRLESRTLAEIAKAE 136

  Fly    67 LDGTRCCGTRIRVEMSSGRS-----------------------------------RDRRRGEG-- 94
            ||||......:|:..::..:                                   |.|..|:|  
Human   137 LDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGPVEKAVVVVDDRGRATGKGFV 201

  Fly    95 ---------GSSGRSGSGRYRITPSARTTSTATSSFYN---------INNLQQ------QPSSQP 135
                     .:..|.|.|.:.:|.:.|.........::         :...||      ||....
Human   202 EFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQKTQQYHKEREQPPRFA 266

  Fly   136 QPATFNLQ 143
            ||.||..:
Human   267 QPGTFEFE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 22/68 (32%)
PSPC1NP_001035879.1 RRM1_PSP1 81..151 CDD:241030 23/70 (33%)
Sufficient for paraspeckles localization 125..358 27/150 (18%)
RRM2_PSP1 157..236 CDD:241033 9/78 (12%)
NOPS_PSPC1 227..320 CDD:240584 9/48 (19%)
Sufficient for perinucleolar caps localization and interaction with NONO. /evidence=ECO:0000269|PubMed:16148043 231..358 8/44 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 460..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.