Sequence 1: | NP_731510.1 | Gene: | Rbp1 / 41294 | FlyBaseID: | FBgn0260944 | Length: | 144 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035879.1 | Gene: | PSPC1 / 55269 | HGNCID: | 20320 | Length: | 523 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 41/203 - (20%) |
---|---|---|---|
Similarity: | 70/203 - (34%) | Gaps: | 62/203 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 PRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRA 66
Fly 67 LDGTRCCGTRIRVEMSSGRS-----------------------------------RDRRRGEG-- 94
Fly 95 ---------GSSGRSGSGRYRITPSARTTSTATSSFYN---------INNLQQ------QPSSQP 135
Fly 136 QPATFNLQ 143 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rbp1 | NP_731510.1 | RRM_SRSF3_like | 12..81 | CDD:409808 | 22/68 (32%) |
PSPC1 | NP_001035879.1 | RRM1_PSP1 | 81..151 | CDD:241030 | 23/70 (33%) |
Sufficient for paraspeckles localization | 125..358 | 27/150 (18%) | |||
RRM2_PSP1 | 157..236 | CDD:241033 | 9/78 (12%) | ||
NOPS_PSPC1 | 227..320 | CDD:240584 | 9/48 (19%) | ||
Sufficient for perinucleolar caps localization and interaction with NONO. /evidence=ECO:0000269|PubMed:16148043 | 231..358 | 8/44 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 460..523 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |