DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and SF2

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster


Alignment Length:115 Identity:46/115 - (40%)
Similarity:57/115 - (49%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CKVYVGNLGSSASKHEIEGAFAKYG-----PLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGT 70
            |::|||||.......:|:..|.|:|     .|:|   .|.|| ||||||||.|||:||.:|.||.
  Fly     7 CRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKN---RRGPP-FAFVEFEDARDADDAVKARDGY 67

  Fly    71 RCCGTRIRVEM---------SSGRSRDRRRGEGGSSGRSG----SGRYRI 107
            ...|.|:|||.         ..|...||.|..||..|..|    ..:||:
  Fly    68 DYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRV 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 34/73 (47%)
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 36/76 (47%)
RRM2_SRSF1_like 115..188 CDD:410013 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.