DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and srsf3

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_012815513.1 Gene:srsf3 / 448605 XenbaseID:XB-GENE-490817 Length:183 Species:Xenopus tropicalis


Alignment Length:131 Identity:70/131 - (53%)
Similarity:80/131 - (61%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YREWD------------LACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFED 56
            |||.:            |.|||||||||::.:|.|:|.||..|||||:|||||||||||||||||
 Frog    10 YREMNSDSSAMHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFED 74

  Fly    57 RRDAEDATRALDGTRCCGTRIRVEMSSGRSRDRRRGEGGSSGRSGSGRY-RITPSARTTSTATSS 120
            .|||.||.|.|||...||.|:|||:|:|..|.|.||...|..|.....| |.:|..|..|....|
 Frog    75 PRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWNRRPRDDYRRRSPPPRRRSPRRRS 139

  Fly   121 F 121
            |
 Frog   140 F 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 49/68 (72%)
srsf3XP_012815513.1 RRM <11..>112 CDD:223796 60/100 (60%)
RRM_SF 25..105 CDD:302621 54/79 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48274
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - mtm9334
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.