DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and srsf7a

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_991236.1 Gene:srsf7a / 402972 ZFINID:ZDB-GENE-040426-1798 Length:258 Species:Danio rerio


Alignment Length:125 Identity:63/125 - (50%)
Similarity:80/125 - (64%) Gaps:16/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGT 75
            ||||||:||:.|:|.|:|.||:.|||||:||||||||||||||:||.||||||.:.:||...||.
Zfish    14 CKVYVGDLGNGAAKGELERAFSYYGPLRSVWVARNPPGFAFVEYEDARDAEDAVKGMDGKVLCGA 78

  Fly    76 RIRVEMSSGRSRDRRRG--------------EGGSSGRSGSGRYRITP--SARTTSTATS 119
            |:|||:|:|.||..|.|              :.|.:|......||.:.  |.|:.|.:.|
Zfish    79 RVRVELSNGMSRKSRYGRPSRRQFDPNDRCYQCGETGHYAYDCYRFSKRRSRRSRSGSRS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 47/68 (69%)
srsf7aNP_991236.1 RRM_SRSF3_like 15..87 CDD:240819 49/71 (69%)
zf-CCHC 108..121 CDD:278525 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I6726
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.