DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and rbm14b

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:145 Identity:37/145 - (25%)
Similarity:63/145 - (43%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGTR 76
            ||:||||.|..:..:::..|..:|   .|.......|:|||..|::.||..|..||.||...|..
Zfish    84 KVFVGNLSSMCTTEDLQELFQTFG---KVLECDKVKGYAFVHMENKEDALQAIEALHGTSFKGRP 145

  Fly    77 IRVEMSSGR-SRDRRRG---------EGGSSGRSGSGR-----YRITPSARTTSTATSSFYNINN 126
            :.||:|..: |:....|         :|..:|...:|:     |:...:....:.|.::...:..
Zfish   146 LSVELSKVQPSKQTPTGKIPCVSCGKQGHYAGECPAGKPTLEQYQSQAAVLAAAAAAAAGLPLQV 210

  Fly   127 LQQQPSSQPQPATFN 141
            .|...:|....:||:
Zfish   211 QQSVHNSVYNTSTFD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 24/68 (35%)
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052
RRM1_2_CoAA_like 84..149 CDD:240789 23/67 (34%)
AIR1 <150..>187 CDD:331526 6/36 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.