DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and srsf3a

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001002053.1 Gene:srsf3a / 368925 ZFINID:ZDB-GENE-030616-631 Length:174 Species:Danio rerio


Alignment Length:123 Identity:70/123 - (56%)
Similarity:78/123 - (63%) Gaps:8/123 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 REWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDG 69
            |:..|.|||||||||:|.:|.|:|.||..|||||:|||||||||||||||||.|||.||.|.|||
Zfish     8 RDCPLDCKVYVGNLGNSGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDATDAVRELDG 72

  Fly    70 TRCCGTRIRVEMSSGRSRDRRRGEGGSSGRSGSGRY--------RITPSARTTSTATS 119
            ...||.|:|||||:|..|.|.||...|..|.....|        |.:|.||..|...|
Zfish    73 RTLCGCRVRVEMSNGEKRSRFRGPPPSWSRRPRDDYRRGDDYRRRSSPPARHRSPRRS 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 50/68 (74%)
srsf3aNP_001002053.1 RRM_SF 10..90 CDD:302621 56/79 (71%)
RRM <13..>97 CDD:223796 59/83 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596090
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.800

Return to query results.
Submit another query.