DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and Srsf7

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001034124.2 Gene:Srsf7 / 362687 RGDID:1307425 Length:238 Species:Rattus norvegicus


Alignment Length:134 Identity:69/134 - (51%)
Similarity:82/134 - (61%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATR 65
            |.||..:....||||||||:.|.|.|:|.||:.|||||.||:||||||||||||||.||||||.|
  Rat     1 MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVR 65

  Fly    66 ALDGTRCCGTRIRVEMSSG---RSR-DR-----------RRGEGGSSGRSGSGRYRITPSARTTS 115
            .|||...||:|:|||:|:|   ||| ||           |..|.|..|......:|.:...|:.|
  Rat    66 GLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRS 130

  Fly   116 TATS 119
            .:.|
  Rat   131 RSRS 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 50/68 (74%)
Srsf7NP_001034124.2 RRM_SRSF7 12..88 CDD:410050 53/75 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6379
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.