DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and Srsf10

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_006239282.1 Gene:Srsf10 / 362630 RGDID:1311067 Length:262 Species:Rattus norvegicus


Alignment Length:138 Identity:43/138 - (31%)
Similarity:69/138 - (50%) Gaps:15/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VYVGNLGSSASKHEIEGAFAKYGPLRNVWV-----ARNPPGFAFVEFEDRRDAEDATRALDGTRC 72
            ::|.|:.......::...|.:|||:.:|:|     .|.|.|||:|:|||.||||||...||....
  Rat    12 LFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWI 76

  Fly    73 CGTRIRVEMSSG--RSRDRRRGEGGSSGRSGS-----GRYRITPS---ARTTSTATSSFYNINNL 127
            ||.:|.::.:.|  ::.::.:.:.|.:..|.|     .|||.:.|   .|..|.:.|..||....
  Rat    77 CGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRS 141

  Fly   128 QQQPSSQP 135
            ....:|:|
  Rat   142 YSPRNSRP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 28/72 (39%)
Srsf10XP_006239282.1 RRM_SF 5..99 CDD:418427 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.