DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and rbm14a

DIOPT Version :10

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001108616.1 Gene:rbm14a / 323721 ZFINID:ZDB-GENE-050522-496 Length:471 Species:Danio rerio


Alignment Length:75 Identity:28/75 - (37%)
Similarity:40/75 - (53%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPP----GFAFVEFEDRRDAEDATRALDGTRC 72
            ||:||||.:|.|..::...|:.||.:.:....:..|    |:|||..|.:.|||.|...|.||..
Zfish    84 KVFVGNLCASCSVEDLYDLFSPYGKVLDCDKVKTKPSSLTGYAFVYMEHKEDAEQAIEGLHGTTF 148

  Fly    73 CGTRIRVEMS 82
            .|..:.||:|
Zfish   149 MGRPLAVELS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 26/72 (36%)
rbm14aNP_001108616.1 RRM_SF 7..75 CDD:473069
RRM_SF 84..156 CDD:473069 25/71 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.