DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and Rbp1-like

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001188585.1 Gene:Rbp1-like / 32293 FlyBaseID:FBgn0030479 Length:247 Species:Drosophila melanogaster


Alignment Length:184 Identity:106/184 - (57%)
Similarity:117/184 - (63%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATR 65
            ||||||||||||||||||||||||:|||.||:|||||||||||||||||||||||||||||||||
  Fly     1 MPRYREWDLACKVYVGNLGSSASKYEIENAFSKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATR 65

  Fly    66 ALDGTRCCGTRIRVEMSSGRSRDRRRGEGGSSG------------------------RSGSGRYR 106
            .|||||||||||||||||||||:.|.|.||..|                        ..|.||||
  Fly    66 GLDGTRCCGTRIRVEMSSGRSREGRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGGRYR 130

  Fly   107 I-------TPSARTTSTATSSFYNINNLQQ--------------QPSSQPQPAT 139
            |       |.:.|||:|.||....|..:::              :.|:.|.|:|
  Fly   131 IKSSSSTTTSTTRTTTTTTSIIIIIMIIKRTTKKKEKTTTATTTRTSTTPLPST 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 64/68 (94%)
Rbp1-likeNP_001188585.1 RRM <11..>81 CDD:223796 65/69 (94%)
RRM_SRSF3_like 12..81 CDD:240819 64/68 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471348
Domainoid 1 1.000 76 1.000 Domainoid score I3142
eggNOG 1 0.900 - - E1_KOG0107
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I6491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 1 1.000 - - mtm954
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
1110.800

Return to query results.
Submit another query.