DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and Srsf5

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_038967784.1 Gene:Srsf5 / 29667 RGDID:3664 Length:270 Species:Rattus norvegicus


Alignment Length:128 Identity:48/128 - (37%)
Similarity:66/128 - (51%) Gaps:13/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGT 75
            |:|::|.|..:|.:.::|..|..||.:|::.:.|   ||.||||||.|||:||...|||...|..
  Rat     4 CRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKR---GFGFVEFEDPRDADDAVYELDGKELCSE 65

  Fly    76 RIRVEMSSGRSRDRRRGEGGSSGRSGSGR----YRITPSARTTSTATSSFYNINNLQQQPSSQ 134
            |:.:|.:..|||. .||.|..|.|..|.|    .|..|..||.:...     :.||..:.|.|
  Rat    66 RVTIEHARARSRG-GRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLI-----VENLSSRVSWQ 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 28/68 (41%)
Srsf5XP_038967784.1 RRM1_SRSF5 5..74 CDD:410008 29/71 (41%)
RRM2_SRSF5 99..179 CDD:410158 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.