DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and Srsf9

DIOPT Version :10

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001009255.1 Gene:Srsf9 / 288701 RGDID:1309495 Length:221 Species:Rattus norvegicus


Alignment Length:90 Identity:35/90 - (38%)
Similarity:47/90 - (52%) Gaps:12/90 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPG---FAFVEFEDRRDAEDATRALDGTRCC 73
            ::|||||.:...:.::|..|.|||.:|.:.: :|..|   ||||.|||.||||||....:|....
  Rat    15 RIYVGNLPTDVREKDLEDLFYKYGRIREIEL-KNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYG 78

  Fly    74 GTRIRVEMSSGRSRDRRRGEGGSSG 98
            ..|:|||..        |..||..|
  Rat    79 QCRLRVEFP--------RAYGGRGG 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 30/71 (42%)
Srsf9NP_001009255.1 RRM1_SRSF9 15..86 CDD:241042 30/71 (42%)
RRM2_SRSF9 103..186 CDD:410161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..221
Interaction with SAFB1. /evidence=ECO:0000250 188..200
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.