DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and Srsf7

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_666195.1 Gene:Srsf7 / 225027 MGIID:1926232 Length:238 Species:Mus musculus


Alignment Length:134 Identity:69/134 - (51%)
Similarity:82/134 - (61%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATR 65
            |.||..:....||||||||:.|.|.|:|.||:.|||||.||:||||||||||||||.||||||.|
Mouse     1 MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVR 65

  Fly    66 ALDGTRCCGTRIRVEMSSG---RSR-DR-----------RRGEGGSSGRSGSGRYRITPSARTTS 115
            .|||...||:|:|||:|:|   ||| ||           |..|.|..|......:|.:...|:.|
Mouse    66 GLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRS 130

  Fly   116 TATS 119
            .:.|
Mouse   131 RSRS 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 50/68 (74%)
Srsf7NP_666195.1 RRM_SRSF7 12..88 CDD:410050 53/75 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6524
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - O PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.