DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and Srsf3

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_038691.1 Gene:Srsf3 / 20383 MGIID:98285 Length:164 Species:Mus musculus


Alignment Length:114 Identity:68/114 - (59%)
Similarity:77/114 - (67%) Gaps:1/114 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCC 73
            |.|||||||||::.:|.|:|.||..|||||:|||||||||||||||||.|||.||.|.|||...|
Mouse     8 LDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLC 72

  Fly    74 GTRIRVEMSSGRSRDRRRGEGGSSGRSGSGRY-RITPSARTTSTATSSF 121
            |.|:|||:|:|..|.|.||...|.||.....| |.:|..|..|....||
Mouse    73 GCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSF 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 49/68 (72%)
Srsf3NP_038691.1 Sufficient for interaction with NXF1. /evidence=ECO:0000250 1..90 56/81 (69%)
RRM_SRSF3 6..86 CDD:241089 54/77 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 16/41 (39%)
2 X approximate repeats, basic 119..164 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850209
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48274
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.720

Return to query results.
Submit another query.