DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and Y57G11A.5

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_502757.2 Gene:Y57G11A.5 / 190364 WormBaseID:WBGene00013293 Length:110 Species:Caenorhabditis elegans


Alignment Length:84 Identity:35/84 - (41%)
Similarity:53/84 - (63%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGTR 76
            :|||||:...|::.|||..|:..||::::|:|:.|||||||.|:....|.||.:.|:|.:.|...
 Worm    18 QVYVGNMPFDATEKEIEAVFSVMGPIKSIWMAKRPPGFAFVTFKRTVHAFDAVKYLNGKKICDLE 82

  Fly    77 IRVEMSSGRSRD--RRRGE 93
            .:|||.....::  |||.|
 Worm    83 AKVEMCEVDFKEDLRRRME 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 29/68 (43%)
Y57G11A.5NP_502757.2 RRM_SF 19..87 CDD:388407 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48274
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101439
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.