DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and rnp-1

DIOPT Version :10

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001256408.1 Gene:rnp-1 / 179672 WormBaseID:WBGene00004384 Length:305 Species:Caenorhabditis elegans


Alignment Length:76 Identity:17/76 - (22%)
Similarity:36/76 - (47%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCCGTR 76
            |::||||..:...::::..|..:..:....:.:|   :|||..|: .|.:.....|.|....|..
 Worm     4 KLFVGNLPDNVDSNKLKQVFQPFCKVTECDIVKN---YAFVHIEE-DDVDPIITRLTGYTIDGKV 64

  Fly    77 IRVEMSSGRSR 87
            :.::.|:.:.|
 Worm    65 VNIKKSTSKLR 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 15/68 (22%)
rnp-1NP_001256408.1 RRM1_2_CoAA_like 4..68 CDD:409779 15/67 (22%)
PRK12323 <188..>302 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.