DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and rsp-3

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001370111.1 Gene:rsp-3 / 176688 WormBaseID:WBGene00004700 Length:258 Species:Caenorhabditis elegans


Alignment Length:131 Identity:56/131 - (42%)
Similarity:63/131 - (48%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRYREWDLACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWV-ARNPPGFAFVEFEDRRDAEDAT 64
            |||....|.  |||||||.....:.|:|..|.|||.::.|.: :...|.||||||||.||||||.
 Worm     1 MPRGGSEDQ--KVYVGNLPGDVREKEVEDIFHKYGRIKYVDIKSGRGPAFAFVEFEDHRDAEDAV 63

  Fly    65 RALDGTRCCGTRIRVEMSSG-----------------RSRDRRRGEGGSSGRSGSGRYRITPSAR 112
            ||.||....|.|||||.:.|                 |..|.|.|.||  ||.|.      |..|
 Worm    64 RARDGYEFDGRRIRVEFTRGVGPRGPGGRPLQDGGDHRGGDFRGGRGG--GRGGG------PQRR 120

  Fly   113 T 113
            |
 Worm   121 T 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 38/69 (55%)
rsp-3NP_001370111.1 RRM1_SRSF1_like 10..80 CDD:409775 38/69 (55%)
RRM2_SRSF1_like 123..196 CDD:410013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.