DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and rsp-1

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_496442.1 Gene:rsp-1 / 174748 WormBaseID:WBGene00004698 Length:312 Species:Caenorhabditis elegans


Alignment Length:94 Identity:39/94 - (41%)
Similarity:56/94 - (59%) Gaps:3/94 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LACKVYVGNLGSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDGTRCC 73
            :|.::|:|.|.|..|:.:||..|..||.:|:| :.:|  ||.||||:|:||||||...|:|....
 Worm     1 MAARIYIGRLTSRVSEKDIEHFFRGYGQIRDV-LLKN--GFGFVEFDDKRDAEDAVHDLNGKELG 62

  Fly    74 GTRIRVEMSSGRSRDRRRGEGGSSGRSGS 102
            |.|:.::.|..|.....||..|..||.|:
 Worm    63 GERVILDYSKPRGGGGDRGGFGGGGRGGA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 30/68 (44%)
rsp-1NP_496442.1 RRM <3..180 CDD:223796 38/92 (41%)
RRM1_SRSF4_like 4..73 CDD:240783 31/71 (44%)
RRM2_SRSF4_like 129..200 CDD:241044
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.