DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and RBM14-RBM4

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001185774.1 Gene:RBM14-RBM4 / 100526737 HGNCID:38840 Length:339 Species:Homo sapiens


Alignment Length:190 Identity:42/190 - (22%)
Similarity:59/190 - (31%) Gaps:82/190 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KVYVGNL-GSSASKHEIEGAFAKYGPLRNVWVARNPPGFAFVEFEDRRDAEDATRALDG------ 69
            |::|||: |:..:..|:...||.||.:.:..|.:.   ||||...:...|..|..||.|      
Human     2 KIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQ---FAFVHMRENAGALRAIEALHGHELRPG 63

  Fly    70 -----------------------TRCC----------------------GTRIRVEMSSGRSRDR 89
                                   :..|                      |.|:.|::|:.|.| .
Human    64 RALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKGKRMHVQLSTSRLR-T 127

  Fly    90 RRGEGGSSG--RSG-------------SGR-----------YRITPSARTTSTATSSFYN 123
            ..|.|..||  |.|             |||           |....:..|.|...|.:||
Human   128 APGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLYYN 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 24/120 (20%)
RBM14-RBM4NP_001185774.1 RRM1_CoAA 1..71 CDD:241052 20/71 (28%)
RRM_SF 79..>113 CDD:302621 1/33 (3%)
ZnF_C2HC 136..151 CDD:197667 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.