DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbp1 and srsf3b

DIOPT Version :9

Sequence 1:NP_731510.1 Gene:Rbp1 / 41294 FlyBaseID:FBgn0260944 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_021324965.1 Gene:srsf3b / 100145909 ZFINID:ZDB-GENE-071005-2 Length:358 Species:Danio rerio


Alignment Length:57 Identity:19/57 - (33%)
Similarity:25/57 - (43%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 MSSGRSRDRRRGEGGSSGRS-GSGRY---RITPSA-RTTSTATSSFYNINNLQQQPS 132
            |:.|...|..:||...|..: |.||.   ..||.| |.:...||.|.:....:|.||
Zfish     1 MAYGFKADSFKGEENMSDLTFGRGRLFANSSTPVAGRGSVGRTSEFCSTRVTEQTPS 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbp1NP_731510.1 RRM_SRSF3_like 12..81 CDD:409808 19/57 (33%)
srsf3bXP_021324965.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0107
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48274
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101439
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X550
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.