powered by:
Protein Alignment Rbp1 and srsf3b
DIOPT Version :9
Sequence 1: | NP_731510.1 |
Gene: | Rbp1 / 41294 |
FlyBaseID: | FBgn0260944 |
Length: | 144 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021324965.1 |
Gene: | srsf3b / 100145909 |
ZFINID: | ZDB-GENE-071005-2 |
Length: | 358 |
Species: | Danio rerio |
Alignment Length: | 57 |
Identity: | 19/57 - (33%) |
Similarity: | 25/57 - (43%) |
Gaps: | 5/57 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 MSSGRSRDRRRGEGGSSGRS-GSGRY---RITPSA-RTTSTATSSFYNINNLQQQPS 132
|:.|...|..:||...|..: |.||. ..||.| |.:...||.|.:....:|.||
Zfish 1 MAYGFKADSFKGEENMSDLTFGRGRLFANSSTPVAGRGSVGRTSEFCSTRVTEQTPS 57
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Rbp1 | NP_731510.1 |
RRM_SRSF3_like |
12..81 |
CDD:409808 |
19/57 (33%) |
srsf3b | XP_021324965.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170596089 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0107 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG48274 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000474 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101439 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR23147 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X550 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.710 |
|
Return to query results.
Submit another query.