DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL37 and MRPL37

DIOPT Version :9

Sequence 1:NP_524306.3 Gene:mRpL37 / 41293 FlyBaseID:FBgn0261380 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001317531.1 Gene:MRPL37 / 51253 HGNCID:14034 Length:483 Species:Homo sapiens


Alignment Length:324 Identity:84/324 - (25%)
Similarity:141/324 - (43%) Gaps:62/324 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 REKPVPEDSRHPDWHPTVCNTYSDNSVLIGGLPQAQVLTNSIVIQTFPK-----------HIEDA 119
            |..|:.|   ||.:....|..:.....|:.|:.||..||.:.:|:..|:           |||:.
Human    89 RSPPLHE---HPLYKDQACYIFHHRCRLLEGVKQALWLTKTKLIEGLPEKVLSLVDDPRNHIENQ 150

  Fly   120 IASQQLPNSVDKSVRHAILASHVLDAEQVKLPKVRLPERPAFNLPRSYGISHERVNRLLVNKLLH 184
                      |:.|.:.|..:.:....:      .:|:|..: .|            ::|:.|:.
Human   151 ----------DECVLNVISHARLWQTTE------EIPKRETY-CP------------VIVDNLIQ 186

  Fly   185 --ESEKLAGRSVSVRRKLIDNASFKTFLSKDGDLL------GFSINAE---KVVFANRAIEGVKG 238
              :|:.|...|:: ||..:.|::|....:::..||      |..::.:   ..:.:...||..|.
Human   187 LCKSQILKHPSLA-RRICVQNSTFSATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKN 250

  Fly   239 KFEGDLPDLYPMKSTISIPKYHIYQAKNLYPLRSDITCSHPHTIFTVFNKHQVKNSHGSEVTTSQ 303
            ..   |...||:...|.:.:.:||..||....:......:|||::.:    ...|.....:...|
Human   251 HV---LETFYPISPIIDLHECNIYDVKNDTGFQEGYPYPYPHTLYLL----DKANLRPHRLQPDQ 308

  Fly   304 LQARTLVKAFVVAAARAKQLHGDSVGALPKPIVVQSVQTDGRTFHFGVLQLNTLDLGANSTAKN 367
            |:|:.::.||..|.|:|:.|:|:....|.:|:|||||.||||.|||.|.||||.||..|...||
Human   309 LRAKMILFAFGSALAQARLLYGNDAKVLEQPVVVQSVGTDGRVFHFLVFQLNTTDLDCNEGVKN 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL37NP_524306.3 PDCD9 <334..405 CDD:284543 23/34 (68%)
MRPL37NP_001317531.1 PDCD9 <218..385 CDD:284543 52/162 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159138
Domainoid 1 1.000 67 1.000 Domainoid score I9906
eggNOG 1 0.900 - - E1_2C9WK
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9536
Inparanoid 1 1.050 87 1.000 Inparanoid score I5157
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1281130at2759
OrthoFinder 1 1.000 - - FOG0007290
OrthoInspector 1 1.000 - - oto91571
orthoMCL 1 0.900 - - OOG6_107906
Panther 1 1.100 - - LDO PTHR15889
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3514
SonicParanoid 1 1.000 - - X6177
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.