DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIFbeta and TFG2

DIOPT Version :9

Sequence 1:NP_524305.2 Gene:TfIIFbeta / 41290 FlyBaseID:FBgn0010421 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_011519.3 Gene:TFG2 / 852888 SGDID:S000003237 Length:400 Species:Saccharomyces cerevisiae


Alignment Length:360 Identity:82/360 - (22%)
Similarity:144/360 - (40%) Gaps:117/360 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DKEKTQIIDK--DLDLSNAGRGVWLVKVPKYIAQKWEKAPT--NMDVGKLRINKTPGQKAQVSLS 65
            :..:|::.::  ||||..:.|.||||::|.::|:||.....  ..::||:|||| .|.|  ::|.
Yeast    46 ENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNLHGQELGKIRINK-DGSK--ITLL 107

  Fly    66 LTPAVLALDPEEKIPTEHILDVSQVTKQTLGVFSHMAPSDGKENSTTSAAQPDNEKLYMEGRIVQ 130
            |..     :..:.||.|:.|::::...:...||:.                 .|.|.|.:.:  :
Yeast   108 LNE-----NDNDSIPHEYDLELTKKVVENEYVFTE-----------------QNLKKYQQRK--K 148

  Fly   131 KLECRPIAD-NCYMKL--KLESIRKASEPQRR------------------------VQPIDK--- 165
            :||..|... ..|:|.  :.|.::|..:.|:|                        |:.|.|   
Yeast   149 ELEADPEKQRQAYLKKQEREEELKKKQQQQKRRNNRKKFNHRVMTDRDGRDRYIPYVKTIPKKTA 213

  Fly   166 IV---------------QNFKPVKDHAHNIEY--------------------------------- 182
            ||               .|:..:.:...||..                                 
Yeast   214 IVGTVCHECQVMPSMNDPNYHKIVEQRRNIVKLNNKERITTLDETVGVTMSHTGMSMRSDNSNFL 278

  Fly   183 ---RERKKAEGKKARDDKNAVMDMLFHAFEKHQYYNIKDLVKITNQPISYLKEILKDVCDYNMKN 244
               ||:.|:..|..|..|..::|.||..|:::.|:::|.|.:.|.||.::|||.|..|.....|.
Yeast   279 KVGREKAKSNIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKG 343

  Fly   245 PHKNMWELKKEYRHYKTEEKKE-----EEHKSGSS 274
            |:...:.|:.||:..|.||:|.     .:.::||:
Yeast   344 PYAFKYTLRPEYKKLKEEERKATLGELADEQTGSA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIFbetaNP_524305.2 TFIIF_beta 20..253 CDD:280438 68/315 (22%)
TFG2NP_011519.3 TFG2 33..400 CDD:227421 82/360 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345768
Domainoid 1 1.000 47 1.000 Domainoid score I3043
eggNOG 1 0.900 - - E1_COG5090
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I1693
Isobase 1 0.950 - 0 Normalized mean entropy S2504
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002863
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102568
Panther 1 1.100 - - LDO PTHR10445
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1466
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.