DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIFbeta and AT1G75510

DIOPT Version :9

Sequence 1:NP_524305.2 Gene:TfIIFbeta / 41290 FlyBaseID:FBgn0010421 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_177683.1 Gene:AT1G75510 / 843887 AraportID:AT1G75510 Length:261 Species:Arabidopsis thaliana


Alignment Length:287 Identity:72/287 - (25%)
Similarity:118/287 - (41%) Gaps:62/287 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DLDLSNAGRGVWLVKVPKYIAQKWEKAPTNMDVGKLRINKTPGQKAQVSLSLTPAVLALDPEEK- 78
            :||:..:.|.:||:|.|..:.:.|.|...:.. .....:.:|...|::...:.|......||.| 
plant     6 NLDIEKSDRSIWLMKCPVVVDKAWHKIAASSS-SSFASSDSPPDMAKIVREVDPLRDDSPPEFKM 69

  Fly    79 --IPTEHILDVSQVTK-QTLGVFSHMAPSDG--KENSTTSAAQPDNEKLYMEGRIVQKLECRPIA 138
              :..|:    ..:.| ..|.:|:...|..|  ..|...:||         ||::..|.:.:|..
plant    70 YMVGAEY----GNMPKCYALNMFTDFVPMGGFSDVNQGCAAA---------EGKVDHKFDMKPYG 121

  Fly   139 DNC--YMKLKLESIRKASEPQRRVQPIDK---------------IVQNFK------PVKDHAHNI 180
            :..  |.:|..|...||....|::|.||.               :..|.|      ||       
plant   122 ETIEEYARLCRERTSKAMVKNRQIQVIDNDRGVHMRPMPGMLGLVSSNSKEKRKPPPV------- 179

  Fly   181 EYRERKKAEGKKARDDKNAVMDMLFHAFEKHQYYNIKDLVKITNQPISYLKEILKDVCDYNMKNP 245
                 |:.|.|:.|.|:..:..::|..||....:.:|.||:.|:||..:|||||.::|.||.:..
plant   180 -----KQTEVKRTRRDRGELEAIMFKLFEGQPNWTLKQLVQETDQPAQFLKEILNELCVYNKRGS 239

  Fly   246 HKNMWELKKEYRHYKTEEKKEEEHKSG 272
            ::..:|||.||       ||..|..:|
plant   240 NQGTYELKPEY-------KKSAEDDTG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIFbetaNP_524305.2 TFIIF_beta 20..253 CDD:280438 62/261 (24%)
AT1G75510NP_177683.1 TFIIF_beta 2..256 CDD:413205 70/282 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I4010
eggNOG 1 0.900 - - E1_COG5090
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I2355
OMA 1 1.010 - - QHG55375
OrthoDB 1 1.010 - - D1496393at2759
OrthoFinder 1 1.000 - - FOG0002863
OrthoInspector 1 1.000 - - otm3406
orthoMCL 1 0.900 - - OOG6_102568
Panther 1 1.100 - - LDO PTHR10445
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.