DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TfIIFbeta and tfg2

DIOPT Version :9

Sequence 1:NP_524305.2 Gene:TfIIFbeta / 41290 FlyBaseID:FBgn0010421 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_595082.1 Gene:tfg2 / 2539924 PomBaseID:SPBC1198.13c Length:307 Species:Schizosaccharomyces pombe


Alignment Length:306 Identity:77/306 - (25%)
Similarity:131/306 - (42%) Gaps:64/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKEDKE-KTQIIDK------DLDLSNAGRGVWLVKVPKYIAQKWEKAPTNMDVGKLRINKTPGQ 58
            ||:|... :|:..|:      ||||...|..|||||:||::..||...|.: |...|...:....
pombe     1 MSEEKPTVRTEEDDRYEDDAGDLDLGQIGSRVWLVKIPKFLMDKWNSIPED-DAANLGCVRVKND 64

  Fly    59 KAQVSLSLTPAVLALDPEEKIPTEHILDVSQVTKQTLGVFSHMAPSDGKENSTTSAAQPDNEKLY 123
            :.|:.|..:|      ....:|..:.|.|.....:...||        :|:.|:|:.    :...
pombe    65 EIQLLLQNSP------ENADVPKIYNLRVMNKFVRNSYVF--------RESETSSSM----KSTA 111

  Fly   124 MEGRIVQKLECRPIADNCYMKLKLESIRKASEPQRRVQPID--------------------KIVQ 168
            :.|.:..:....|:.::.|.::..:....||.|:|:||.||                    ..::
pombe   112 LVGTVAHECNVSPVINDDYRRVMQKRALAASAPKRKVQMIDDRGGSLLAPGTLGSRSRSTTSFIR 176

  Fly   169 NFKPVKDHAHNIEYRERKKAEG-KKARDDKNAVMDMLFHAFEKHQYYNIKDLVKITNQPISYLKE 232
            |.||             :..|| |.:|..:|.::|:||..||.::|:.:|.|.:...||..||||
pombe   177 NVKP-------------RTGEGLKNSRIPRNELLDILFKCFEDYEYWTLKGLREYVKQPEVYLKE 228

  Fly   233 ILKDVCDYNMKNPHKNMWELKKEYR----HYKTEEKKEEEHKSGSS 274
            :|..:...|.:.|:...:.||.||:    ....|.:.::..:|.||
pombe   229 VLDSIAILNKRGPYALKYSLKPEYKGTMDAASVELRNQQASQSESS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TfIIFbetaNP_524305.2 TFIIF_beta 20..253 CDD:280438 60/253 (24%)
tfg2NP_595082.1 TFG2 1..307 CDD:227421 77/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I3279
eggNOG 1 0.900 - - E1_COG5090
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I1745
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002863
OrthoInspector 1 1.000 - - oto100935
orthoMCL 1 0.900 - - OOG6_102568
Panther 1 1.100 - - LDO PTHR10445
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1466
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.