DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cap-H2 and C29E4.12

DIOPT Version :9

Sequence 1:NP_650014.2 Gene:Cap-H2 / 41289 FlyBaseID:FBgn0037831 Length:960 Species:Drosophila melanogaster
Sequence 2:NP_741234.1 Gene:C29E4.12 / 259333 WormBaseID:WBGene00016209 Length:108 Species:Caenorhabditis elegans


Alignment Length:95 Identity:18/95 - (18%)
Similarity:37/95 - (38%) Gaps:24/95 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   838 NVSLDFENRDKSKPIDMSQFRMHLKSMKRMEI---------NPEDDVGNINAAQSKSTPRSKQLN 893
            |:..:.:..||:...:.:|::..::.||..::         |..:.|..:..:..|.|   :|||
 Worm    17 NIISELKKVDKTFSPNSAQYKYLMEQMKADQVTTRRYSKAENESESVAKLYLSYIKGT---RQLN 78

  Fly   894 DSAHKPRTSTTASAPTKRKSAENSLSEVFA 923
            :            ...:.|..|.|:.|..|
 Worm    79 E------------LQERYKGGEKSVEEAAA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cap-H2NP_650014.2 CNDH2_C <769..844 CDD:293463 1/5 (20%)
C29E4.12NP_741234.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2359
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.