DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED7 and MED7

DIOPT Version :9

Sequence 1:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_014506.1 Gene:MED7 / 853985 SGDID:S000005495 Length:222 Species:Saccharomyces cerevisiae


Alignment Length:221 Identity:67/221 - (30%)
Similarity:106/221 - (47%) Gaps:50/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNQE-TQVSSLPMPPERYIANYTDENIR-------------RNRAPRP---------------- 35
            |||.. .:||||..||..|:..:|..|:.             :..||..                
Yeast     1 MSNDPGNEVSSLYPPPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITCALDYL 65

  Fly    36 -PPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIPIHFDRR--------KELKKLNHSLLVNF 91
             |||..:::.|..||..:...:.:..|||..:.:|.....:..        :||:||..|||:|:
Yeast    66 IPPPMPKNQQYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELRKLLKSLLLNY 130

  Fly    92 LDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMMEMQ---KR---QRVE 150
            |:||..|.:|||...|  |:::|..:.||:||||||:||||:||:|.:::|.|   ||   :.:|
Yeast   131 LELIGVLSINPDMYER--KVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIE 193

  Fly   151 TAARFQKH--LERVREIVNTAFSALP 174
            ...: |.|  |..:::.:.|...:.|
Yeast   194 QVCK-QVHDKLTSIQDTLRTGSQSPP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 62/203 (31%)
MED7NP_014506.1 Med7 21..203 CDD:399168 57/200 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346139
Domainoid 1 1.000 83 1.000 Domainoid score I1942
eggNOG 1 0.900 - - E1_KOG0570
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1594
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004483
OrthoInspector 1 1.000 - - oto99354
orthoMCL 1 0.900 - - OOG6_103150
Panther 1 1.100 - - LDO PTHR21428
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R706
SonicParanoid 1 1.000 - - X3177
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.