DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED7 and AT5G03500

DIOPT Version :9

Sequence 1:NP_731500.1 Gene:MED7 / 41288 FlyBaseID:FBgn0051390 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001330958.1 Gene:AT5G03500 / 831822 AraportID:AT5G03500 Length:178 Species:Arabidopsis thaliana


Alignment Length:162 Identity:60/162 - (37%)
Similarity:90/162 - (55%) Gaps:6/162 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PPERYIANYTDENIRRNRAPRPPPPPAQHEVYSMFGIQYNNDEMIRSLESQNIKRLIP--IHFDR 76
            ||..|...|.|.:...:.||.||||  ....|..||..|..::::.|||.|.:.:|.|  .:.|.
plant    18 PPPPYYRLYKDFSENTDSAPEPPPP--IEGTYVCFGGNYTTEDVLPSLEEQGVPQLYPKDSNLDY 80

  Fly    77 RKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDISLLFVNMHHLLNEFRPHQARETLRVMM 141
            :|||:.||..|.::.|:|.|.|:..|.  :..::|.:||.:|.|:|||||..||||||.||..:|
plant    81 KKELRSLNRELQLHILELADVLVDRPS--QYAKRIGEISSIFKNLHHLLNSLRPHQARATLIHIM 143

  Fly   142 EMQKRQRVETAARFQKHLERVREIVNTAFSAL 173
            |:|.:||.:.....::..|..:.::..||..|
plant   144 ELQIQQRKQAVEDIKRRREEAQGLLKDAFVTL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED7NP_731500.1 Med7 8..166 CDD:283604 57/153 (37%)
AT5G03500NP_001330958.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2299
eggNOG 1 0.900 - - E1_KOG0570
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3153
Inparanoid 1 1.050 106 1.000 Inparanoid score I2110
OMA 1 1.010 - - QHG57344
OrthoDB 1 1.010 - - D1356482at2759
OrthoFinder 1 1.000 - - FOG0004483
OrthoInspector 1 1.000 - - otm3172
orthoMCL 1 0.900 - - OOG6_103150
Panther 1 1.100 - - O PTHR21428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3177
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.